PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001366m
Common NameCARUB_v10001366mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 339aa    MW: 38975.3 Da    PI: 6.3729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001366mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++ +G g+W+t ++  g+ R++k+c++rw +yl
  Carubv10001366m 15 KGPWTPEEDKKLTDYINIHGYGNWRTLPKNAGLERCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding53.26.8e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  +G++ W++Ia++++ gRt++++k++w+++
  Carubv10001366m  68 RGRFSFEEEETIIQLHSIMGNK-WSAIAARLP-GRTDNEIKNYWNTH 112
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3181062IPR017930Myb domain
SuperFamilySSF466894.03E-3112109IPR009057Homeodomain-like
SMARTSM007173.3E-131464IPR001005SANT/Myb domain
PfamPF002493.2E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-241669IPR009057Homeodomain-like
CDDcd001671.80E-111762No hitNo description
PROSITE profilePS5129425.02363117IPR017930Myb domain
SMARTSM007171.3E-1667115IPR001005SANT/Myb domain
PfamPF002492.4E-1568112IPR001005SANT/Myb domain
CDDcd001675.18E-1270113No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRSPCCEKK NGLKKGPWTP EEDKKLTDYI NIHGYGNWRT LPKNAGLERC GKSCRLRWTN  60
YLRPDIKRGR FSFEEEETII QLHSIMGNKW SAIAARLPGR TDNEIKNYWN THIRKRLLKM  120
GIDPVTHSPR LDLLDISSIL NSSLFNSSHH HQHMNMSTRL MMMGDGHSHQ SLVDPEILKL  180
ATSLFSNQNN THENQTEVNQ YQTGYNMSSN QELQYWFPIM DQFTEFQDLI TPMKTTVQDS  240
TPSLPSNYDD DYSKSNSVLE PFYSDFASVL TTPSSSPTPL NSSSTTYINS STCSTEDEKE  300
SYYSNNNITS TSEIPDYSFD VNGFLQFQET RNHWDRVM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27131175108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00429DAPTransfer from AT4G05100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3869320.0AF386932.1 Arabidopsis thaliana Unknown protein mRNA, complete cds.
GenBankBT0011820.0BT001182.1 Arabidopsis thaliana Unknown protein (At4g05100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288136.10.0hypothetical protein CARUB_v10001366mg
TrEMBLR0GVX20.0R0GVX2_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0006_35840.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.11e-142myb domain protein 74